IL15RA (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8350
Artikelname: IL15RA (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8350
Hersteller Artikelnummer: P8350
Alternativnummer: ABN-P8350-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL15RA (Q13261, 31 a.a. - 205 a.a.) partial recombinant protein with hlgG-His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3601
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
Target-Kategorie: IL15RA
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.