IL17A (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8357
Artikelname: IL17A (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8357
Hersteller Artikelnummer: P8357
Alternativnummer: ABN-P8357-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL17A (Q16552, 24 a.a. - 155 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 3605
Puffer: In 25mM Na-Acetate pH 4.8 (50% glycerol)
Formulierung: Liquid
Sequenz: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Target-Kategorie: IL17A
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.