IL17A (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8358
Artikelname: IL17A (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8358
Hersteller Artikelnummer: P8358
Alternativnummer: ABN-P8358-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL17A (Q16552, 24 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 3605
Puffer: In 20mM PBS pH 7.4 (0.1mM PMSF, 1mM EDTA, 20% glycerol)
Formulierung: Liquid
Sequenz: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
Target-Kategorie: IL17A
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.