IL17A (Human) Recombinant Protein, Insect
Artikelnummer:
ABN-P8358
- Bilder (0)
Artikelname: | IL17A (Human) Recombinant Protein, Insect |
Artikelnummer: | ABN-P8358 |
Hersteller Artikelnummer: | P8358 |
Alternativnummer: | ABN-P8358-2 |
Hersteller: | Abnova |
Wirt: | Insect |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human IL17A (Q16552, 24 a.a. - 155 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells. |
Tag: | His |
UniProt: | 3605 |
Puffer: | In 20mM PBS pH 7.4 (0.1mM PMSF, 1mM EDTA, 20% glycerol) |
Formulierung: | Liquid |
Sequenz: | GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH |
Target-Kategorie: | IL17A |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |