IL17B (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8360
Artikelname: IL17B (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8360
Hersteller Artikelnummer: P8360
Alternativnummer: ABN-P8360-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL17B (Q9UHF5, 20 a.a. - 180 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 27190
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Target-Kategorie: IL17B
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.