IL17B (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P8361
- Bilder (0)
Artikelname: | IL17B (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P8361 |
Hersteller Artikelnummer: | P8361 |
Alternativnummer: | ABN-P8361-25 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human IL17B (Q9UHF5, 21 a.a. - 180 a.a.) partial recombinant protein with His-tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 27190 |
Puffer: | In 20mM Tris-HCl buffer pH 8.0 (0.4M Urea, 10% glycerol) |
Formulierung: | Liquid |
Sequenz: | MGSSHHHHHHSSGLVPRGSHMGSHMQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF |
Target-Kategorie: | IL17B |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |