IL17B (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8361
Artikelname: IL17B (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8361
Hersteller Artikelnummer: P8361
Alternativnummer: ABN-P8361-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL17B (Q9UHF5, 21 a.a. - 180 a.a.) partial recombinant protein with His-tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 27190
Puffer: In 20mM Tris-HCl buffer pH 8.0 (0.4M Urea, 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Target-Kategorie: IL17B
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.