IL17B (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8362
Artikelname: IL17B (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8362
Hersteller Artikelnummer: P8362
Alternativnummer: ABN-P8362-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL17B (Q9UHF5, 21 a.a. - 180 a.a.) partial recombinant protein with His-tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 27190
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIFHHHHHH
Target-Kategorie: IL17B
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.