IL17D (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8363
Artikelname: IL17D (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8363
Hersteller Artikelnummer: P8363
Alternativnummer: ABN-P8363-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL17D (Q8TAD2, 21 a.a. - 180 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 53342
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: APRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Target-Kategorie: IL17D
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.