IL25 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8364
Artikelname: IL25 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8364
Hersteller Artikelnummer: P8364
Alternativnummer: ABN-P8364-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL25 (Q9H293, 33 a.a. - 177 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 64806
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Target-Kategorie: IL25
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.