IL25 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P8365
Artikelname: IL25 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P8365
Hersteller Artikelnummer: P8365
Alternativnummer: ABN-P8365-2
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL25 (Q9H293, 33 a.a. - 177 a.a.) partial recombinant protein with His-tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 64806
Puffer: In PBS pH 7.4 (20% glycerol)
Formulierung: Liquid
Sequenz: DGSYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMGHHHHHH
Target-Kategorie: IL25
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.