IL17F (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8366
Artikelname: IL17F (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8366
Hersteller Artikelnummer: P8366
Alternativnummer: ABN-P8366-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL17F (Q96PD4, 30 a.a. - 163 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 112744
Puffer: Lyophilized from sterile distilled Water is < 1 mg/mL
Formulierung: Liquid
Sequenz: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Target-Kategorie: IL17F
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.