IL17F (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8367
Artikelname: IL17F (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8367
Hersteller Artikelnummer: P8367
Alternativnummer: ABN-P8367-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL17F (Q96PD4, 31 a.a. - 163 a.a.) partial recombinant protein with His-tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 112744
Puffer: In 20mM Tris-HCl buffer pH 8.0 (0.4M Urea, 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Target-Kategorie: IL17F
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.