IL17F (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P8368
Artikelname: IL17F (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P8368
Hersteller Artikelnummer: P8368
Alternativnummer: ABN-P8368-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human IL17F (Q96PD4, 31 a.a. - 163 a.a.) partial recombinant protein with His-tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 112744
Puffer: In PBS pH 7.4 (1mM DTT, 20% glycerol)
Formulierung: Liquid
Sequenz: ADPRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQHHHHHH
Target-Kategorie: IL17F
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.