IL17A/F (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8369
Artikelname: IL17A/F (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8369
Hersteller Artikelnummer: P8369
Alternativnummer: ABN-P8369-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human IL17A/F (Q16552, 19 a.a. - 155 a.a., Q96PD4, 30 a.a. - 163 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 3605, 112744
Puffer: Lyophilized from sterile distilled Water up to 1 mg/mL
Formulierung: Lyophilized
Sequenz: MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKV
Target-Kategorie: IL17A
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.