IL17A/F (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P8369
- Bilder (0)
Artikelname: | IL17A/F (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P8369 |
Hersteller Artikelnummer: | P8369 |
Alternativnummer: | ABN-P8369-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA, SDS-PAGE |
Human IL17A/F (Q16552, 19 a.a. - 155 a.a., Q96PD4, 30 a.a. - 163 a.a.) partial recombinant protein expressed in Escherichia coli. |
UniProt: | 3605, 112744 |
Puffer: | Lyophilized from sterile distilled Water up to 1 mg/mL |
Formulierung: | Lyophilized |
Sequenz: | MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKV |
Target-Kategorie: | IL17A |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |