Il17a (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P8370
Artikelname: Il17a (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P8370
Hersteller Artikelnummer: P8370
Alternativnummer: ABN-P8370-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Il17a (Q62386, 29 a.a. - 155 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 16171
Puffer: Lyophilized from sterile distilled Water up to 1 mg/mL
Formulierung: Lyophilized
Sequenz: MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Target-Kategorie: Il17a
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.