BTC (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8498
Artikelname: BTC (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8498
Hersteller Artikelnummer: P8498
Alternativnummer: ABN-P8498-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human BTC (P35070, 32 a.a. - 111 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Tag: His-tag
UniProt: 685
Puffer: The BTC solution (0.25mg/mL) contains 20mM Tris-HCl buffer (pH 8.0), 5mM DTT, 0.2M NaCl and 20% glycerol.
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY.
Target-Kategorie: BTC