CYTL1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P8535
Artikelname: CYTL1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P8535
Hersteller Artikelnummer: P8535
Alternativnummer: ABN-P8535-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human CYTL1 (Q9NRR1, 23 a.a.- 136 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Tag: His-Tag
UniProt: 54360
Puffer: CYTL1 was filtered (0.4 um) and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl, pH 7.5.
Formulierung: Lyophilized
Sequenz: MKHHHHHHASTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR.
Target-Kategorie: CYTL1