LIF (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P8909
- Bilder (0)
| Artikelname: | LIF (Human) Recombinant Protein, E. coli |
| Artikelnummer: | ABN-P8909 |
| Hersteller Artikelnummer: | P8909 |
| Alternativnummer: | ABN-P8909-2 |
| Hersteller: | Abnova |
| Wirt: | E. coli |
| Kategorie: | Proteine/Peptide |
| Applikation: | SDS-PAGE |
| Spezies Reaktivität: | Human |
| Human LIF (P15018, 23 a.a. - 202 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli. |
| Tag: | His-Tag |
| UniProt: | 3976 |
| Puffer: | Lyophilized from 20 mM Tris buffer, 20 mM NaCl and 5% w/v trehalose, pH 7.5. |
| Formulierung: | Lyophilized |
| Sequenz: | MKHHHHHHASPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF. |
| Target-Kategorie: | LIF |
Produktgarantie und fachkundiger Support
