NPPA (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P8980
- Bilder (0)
| Artikelname: | NPPA (Human) Recombinant Protein, E. coli |
| Artikelnummer: | ABN-P8980 |
| Hersteller Artikelnummer: | P8980 |
| Alternativnummer: | ABN-P8980-2 |
| Hersteller: | Abnova |
| Wirt: | E. coli |
| Kategorie: | Proteine/Peptide |
| Applikation: | SDS-PAGE |
| Spezies Reaktivität: | Human |
| Human NPPA (P01160, 26 a.a. - 123 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli. |
| Tag: | His tag |
| UniProt: | 4878 |
| Puffer: | Lyophilized from 20 mM Tris buffer, 50 mM NaCl and 5% w/v trehalosa, pH 7.5. |
| Formulierung: | Lyophilized |
| Sequenz: | MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR. |
| Target-Kategorie: | NPPA |
Produktgarantie und fachkundiger Support
