Pdgfa (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9006
Artikelname: Pdgfa (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9006
Hersteller Artikelnummer: P9006
Alternativnummer: ABN-P9006-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Pdgfa (P20033) recombinant protein expressed in Escherichia coli.
UniProt: 18590
Puffer: The protein was lyophilized with no additives.
Formulierung: Lyophilized
Sequenz: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT.
Target-Kategorie: Pdgfa