CSH1 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9030
Artikelname: CSH1 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9030
Hersteller Artikelnummer: P9030
Alternativnummer: ABN-P9030-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Spezies Reaktivität: Human
Human CSH1 (P0DML2, 27 a.a. - 217 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Tag: His tag
UniProt: 1442
Puffer: Lyophilized from 30% Glycerol and Phosphate-Buffered Saline (pH 7.4).
Formulierung: Liquid
Sequenz: VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGFHHHHHH
Target-Kategorie: CSH1