Dhh (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9139
Artikelname: Dhh (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9139
Hersteller Artikelnummer: P9139
Alternativnummer: ABN-P9139-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA
Spezies Reaktivität: Mouse
Mouse Dhh recombinant protein expressed in Escherichia coli.
UniProt: 13363
Puffer: Lyophilized from a solution containing IX PBS, pH7.4, 1 mM DTT, 0.05% Tween 80. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: IIGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG
Target-Kategorie: Dhh