Retnla (Mouse) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9149
- Bilder (0)
| Artikelname: | Retnla (Mouse) Recombinant Protein, E. coli |
| Artikelnummer: | ABN-P9149 |
| Hersteller Artikelnummer: | P9149 |
| Alternativnummer: | ABN-P9149-25 |
| Hersteller: | Abnova |
| Wirt: | E. coli |
| Kategorie: | Proteine/Peptide |
| Applikation: | SDS-PAGE |
| Spezies Reaktivität: | Mouse |
| Mouse Retnla partial recombinant protein with flagTag in N-terminus expressed in Escherichia coli. |
| Tag: | Flag |
| UniProt: | 57262 |
| Puffer: | Protein (0.5 mg/mL) was lyophilized from a solution containing 5 mM Tris-HCl, pH 7.5, 25 mM NaCl. Reconstitute the lyophilized powder in ddH2O and let the lyophilized pellet dissolve completely. |
| Formulierung: | Lyophilized |
| Sequenz: | MKKLLFAIPLVVPFYSHSTMVNTDETIEIIVENKVKELLANPANYPSTVTTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLSLEDYKDDDDK |
| Target-Kategorie: | Retnla |
Produktgarantie und fachkundiger Support
