RETNLB (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9150
Artikelname: RETNLB (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9150
Hersteller Artikelnummer: P9150
Alternativnummer: ABN-P9150-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Human
Human RETNLB recombinant protein with His tag expressed in Escherichia coli.
Tag: His
UniProt: 84666
Puffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate bufer, pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 10 ug/mL. In higher concentrations the solubility of this antigen is limited.
Formulierung: Lyophilized
Sequenz: MGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLTKLRSHHHHHH
Target-Kategorie: RETNLB