RETNLB (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9150
- Bilder (0)
Artikelname: | RETNLB (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9150 |
Hersteller Artikelnummer: | P9150 |
Alternativnummer: | ABN-P9150-25 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Spezies Reaktivität: | Human |
Human RETNLB recombinant protein with His tag expressed in Escherichia coli. |
Tag: | His |
UniProt: | 84666 |
Puffer: | Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate bufer, pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 10 ug/mL. In higher concentrations the solubility of this antigen is limited. |
Formulierung: | Lyophilized |
Sequenz: | MGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLTKLRSHHHHHH |
Target-Kategorie: | RETNLB |