Retnlb (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9152
Artikelname: Retnlb (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9152
Hersteller Artikelnummer: P9152
Alternativnummer: ABN-P9152-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Retnlb recombinant protein expressed in Escherichia coli.
UniProt: 57263
Puffer: Protein (1 mg/mL) was lyophilized from a solution containing 10 mM Acetic Acid with 2:1 mannitol. Reconstitute the lyophilized powder in ddH2O to 0.1 mg/mL.
Formulierung: Lyophilized
Sequenz: MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
Target-Kategorie: Retnlb