Retnlg (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9154
Artikelname: Retnlg (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9154
Hersteller Artikelnummer: P9154
Alternativnummer: ABN-P9154-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Retnlg recombinant protein with His tag expressed in Escherichia coli.
Tag: His
UniProt: 245195
Puffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate buffer,pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In
Formulierung: Lyophilized
Sequenz: MRGSHHHHHHGMASHMTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Target-Kategorie: Retnlg