Retnlg (Mouse) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9154
- Bilder (0)
Artikelname: | Retnlg (Mouse) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9154 |
Hersteller Artikelnummer: | P9154 |
Alternativnummer: | ABN-P9154-25 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Spezies Reaktivität: | Mouse |
Mouse Retnlg recombinant protein with His tag expressed in Escherichia coli. |
Tag: | His |
UniProt: | 245195 |
Puffer: | Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate buffer,pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In |
Formulierung: | Lyophilized |
Sequenz: | MRGSHHHHHHGMASHMTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA |
Target-Kategorie: | Retnlg |