Retn (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9161
Artikelname: Retn (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9161
Hersteller Artikelnummer: P9161
Alternativnummer: ABN-P9161-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Mouse Retn recombinant protein with flag tag in C-terminus expressed in Escherichia coli.
Tag: flag
UniProt: 57264
Puffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate buffer, pH4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use.
Formulierung: Lyophilized
Sequenz: MKKLLFAIPLVVPFYSHSTMASMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVASLEDYKDDDDK
Target-Kategorie: Retn