Retn (Mouse) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9161
- Bilder (0)
Artikelname: | Retn (Mouse) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9161 |
Hersteller Artikelnummer: | P9161 |
Alternativnummer: | ABN-P9161-25 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Spezies Reaktivität: | Mouse |
Mouse Retn recombinant protein with flag tag in C-terminus expressed in Escherichia coli. |
Tag: | flag |
UniProt: | 57264 |
Puffer: | Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate buffer, pH4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. |
Formulierung: | Lyophilized |
Sequenz: | MKKLLFAIPLVVPFYSHSTMASMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVASLEDYKDDDDK |
Target-Kategorie: | Retn |