TNFRSF13B (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9191
Artikelname: TNFRSF13B (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9191
Hersteller Artikelnummer: P9191
Alternativnummer: ABN-P9191-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA
Spezies Reaktivität: Human
Human TNFRSF13B recombinant protein expressed in Escherichia coli.
UniProt: 23495
Puffer: Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV
Target-Kategorie: TNFRSF13B