TFF2 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9197
- Bilder (0)
Artikelname: | TFF2 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9197 |
Hersteller Artikelnummer: | P9197 |
Alternativnummer: | ABN-P9197-20 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Spezies Reaktivität: | Human |
Human TFF2 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 7032 |
Puffer: | Protein(0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In highe |
Formulierung: | Lyophilized |
Sequenz: | MKHHHHHHASEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY |
Target-Kategorie: | TFF2 |