TFF3 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9198
Artikelname: TFF3 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9198
Hersteller Artikelnummer: P9198
Alternativnummer: ABN-P9198-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA
Spezies Reaktivität: Human
Human TFF3 recombinant protein expressed in Escherichia coli.
UniProt: 7033
Puffer: Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Target-Kategorie: TFF3