TFF3 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9199
- Bilder (0)
| Artikelname: | TFF3 (Human) Recombinant Protein, E. coli |
| Artikelnummer: | ABN-P9199 |
| Hersteller Artikelnummer: | P9199 |
| Alternativnummer: | ABN-P9199-20 |
| Hersteller: | Abnova |
| Wirt: | E. coli |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA |
| Spezies Reaktivität: | Human |
| Human TFF3 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli. |
| Tag: | His |
| UniProt: | 7033 |
| Puffer: | Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In hig |
| Formulierung: | Lyophilized |
| Sequenz: | MKHHHHHHASEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
| Target-Kategorie: | TFF3 |
Produktgarantie und fachkundiger Support
