Tff3 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9200
Artikelname: Tff3 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9200
Hersteller Artikelnummer: P9200
Alternativnummer: ABN-P9200-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Rat
Rat Tff3 recombinant protein with Flag tag in C-terminus expressed in Escherichia coli.
Tag: Flag
UniProt: 25563
Puffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 50 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In high
Formulierung: Lyophilized
Sequenz: MQEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTFDYKDDDDK
Target-Kategorie: Tff3