Tff3 (Rat) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9200
- Bilder (0)
Artikelname: | Tff3 (Rat) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9200 |
Hersteller Artikelnummer: | P9200 |
Alternativnummer: | ABN-P9200-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Spezies Reaktivität: | Rat |
Rat Tff3 recombinant protein with Flag tag in C-terminus expressed in Escherichia coli. |
Tag: | Flag |
UniProt: | 25563 |
Puffer: | Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 50 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In high |
Formulierung: | Lyophilized |
Sequenz: | MQEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTFDYKDDDDK |
Target-Kategorie: | Tff3 |