TGFB1 (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P9202
Artikelname: TGFB1 (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P9202
Hersteller Artikelnummer: P9202
Alternativnummer: ABN-P9202-2
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA
Spezies Reaktivität: Human
Human TGFB1 recombinant protein expressed in CHO cells.
UniProt: 7040
Puffer: Lyophilized from a solution containing 0.1% TFA and trehalose (1:20 protein to Trehalose ratio). Reconstitute the lyophilized powder in 10 mM HCl to 0.1 mg/mL.
Formulierung: Lyophilized
Sequenz: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Target-Kategorie: TGFB1