TNFRSF1A (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9239
Artikelname: TNFRSF1A (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9239
Hersteller Artikelnummer: P9239
Alternativnummer: ABN-P9239-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Spezies Reaktivität: Mouse
Human TNFRSF1A recombinant protein expressed in Escherichia coli.
UniProt: 7132
Puffer: Lyophilized from a solution containing 10 mM sodium phosphate buffer, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESSGSFTASENHLRHCLSCSKCRKEMGQVEKSSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN.
Target-Kategorie: TNFRSF1A