TSLP (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9281
- Bilder (0)
| Artikelname: | TSLP (Human) Recombinant Protein, E. coli |
| Artikelnummer: | ABN-P9281 |
| Hersteller Artikelnummer: | P9281 |
| Alternativnummer: | ABN-P9281-2 |
| Hersteller: | Abnova |
| Wirt: | E. coli |
| Kategorie: | Proteine/Peptide |
| Applikation: | FA |
| Spezies Reaktivität: | Human |
| Human TSLP recombinant protein expressed in Escherichia coli. |
| UniProt: | 85480 |
| Puffer: | Protein (1 mg/mL) was lyophilized from a solution containing 20 mM sodium phosphate, pH 7.4, 130 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Formulierung: | Lyophilized |
| Sequenz: | MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
| Target-Kategorie: | TSLP |
Produktgarantie und fachkundiger Support
