Thpo (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9290
Artikelname: Thpo (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9290
Hersteller Artikelnummer: P9290
Alternativnummer: ABN-P9290-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA
Spezies Reaktivität: Mouse
Mouse Thpo recombinant protein with expressed in Escherichia coli.
UniProt: 21832
Puffer: Protein (1 mg/mL) was lyophilized with no additives. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
Target-Kategorie: Thpo