VEGFA (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9307
Artikelname: VEGFA (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9307
Hersteller Artikelnummer: P9307
Alternativnummer: ABN-P9307-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA
Spezies Reaktivität: Human
Human VEGFA recombinant protein expressed in Insect Cells.
UniProt: 7422
Puffer: Lyophilized from a solution containing 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid to 50 ug/mL.
Formulierung: Lyophilized
Sequenz: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Target-Kategorie: VEGFA