Vegfa (Rat) Recombinant Protein, Insect

Artikelnummer: ABN-P9324
Artikelname: Vegfa (Rat) Recombinant Protein, Insect
Artikelnummer: ABN-P9324
Hersteller Artikelnummer: P9324
Alternativnummer: ABN-P9324-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: FA
Spezies Reaktivität: Rat
Rat Vegfa recombinant proteind with His tag in C-terminus expressed in Insect Cells.
Tag: His
UniProt: 83785
Puffer: Lyophilized from a solution containing 1XPBS, 50 mg BSA. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Formulierung: Lyophilized
Sequenz: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH
Target-Kategorie: Vegfa