VEGFE (Orf Virus) Recombinant Protein, E. coli

Artikelnummer: ABN-P9327
Artikelname: VEGFE (Orf Virus) Recombinant Protein, E. coli
Artikelnummer: ABN-P9327
Hersteller Artikelnummer: P9327
Alternativnummer: ABN-P9327-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA
Spezies Reaktivität: Virus
Orf Virus VEGFE recombinant protein with His tag in N-terminus expressed in?Escherichia coli.
Tag: His
Puffer: Protein (1 mg/mL) was lyophilized from a solution containing PBS. Reconstitute the lyophilized powder in ddH2O to 50 ug/mL. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin.
Formulierung: Lyophilized
Sequenz: MGSSHHHHHHSSGLVPRGSHDSTKTWSEVFENSGCKPRPMVFRVHDEHPELTSQRFNPPCVTLMRCGGCCNDESLECVPTEEANVTMQLMGASVSGGNGMQHLSFVEHKKCDCKPPLTTTPPTTTRPPRRRR