VEGFE (Orf Virus) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9327
- Bilder (0)
Artikelname: | VEGFE (Orf Virus) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9327 |
Hersteller Artikelnummer: | P9327 |
Alternativnummer: | ABN-P9327-2 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | FA |
Spezies Reaktivität: | Virus |
Orf Virus VEGFE recombinant protein with His tag in N-terminus expressed in?Escherichia coli. |
Tag: | His |
Puffer: | Protein (1 mg/mL) was lyophilized from a solution containing PBS. Reconstitute the lyophilized powder in ddH2O to 50 ug/mL. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin. |
Formulierung: | Lyophilized |
Sequenz: | MGSSHHHHHHSSGLVPRGSHDSTKTWSEVFENSGCKPRPMVFRVHDEHPELTSQRFNPPCVTLMRCGGCCNDESLECVPTEEANVTMQLMGASVSGGNGMQHLSFVEHKKCDCKPPLTTTPPTTTRPPRRRR |