CD72 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9394
Artikelname: CD72 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9394
Hersteller Artikelnummer: P9394
Alternativnummer: ABN-P9394-5
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CD72 (P21854, 1 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 971
Puffer: In 50mM Tris-HCl pH 7.5 (10 mM L-glutathione (reduced))
Formulierung: Liquid
Sequenz: MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLL
Target-Kategorie: CD72
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.