MFAP2 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9402
Artikelname: MFAP2 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9402
Hersteller Artikelnummer: P9402
Alternativnummer: ABN-P9402-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human MFAP2 (P55001, 18 a.a. - 183 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 4237
Puffer: In 20mM Tris-HCl pH 8.0 (1 M Urea and 20% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSMQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
Target-Kategorie: MFAP2
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.