MLANA (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9403
Artikelname: MLANA (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9403
Hersteller Artikelnummer: P9403
Alternativnummer: ABN-P9403-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human MLANA (Q16655, 48 a.a. - 118 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 2315
Puffer: In 20mM Tris-HCl pH 8.0 (0.15 M NaCl, 1 mM DTTa and 20% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Target-Kategorie: MLANA
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.