MS4A1 (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9404
Artikelname: MS4A1 (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9404
Hersteller Artikelnummer: P9404
Alternativnummer: ABN-P9404-5
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human MS4A1 (P11836, 210 a.a. - 297 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 931
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: ADPGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSPHHHHHH
Target-Kategorie: MS4A1
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.