PDCD6IP (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9406
Artikelname: PDCD6IP (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9406
Hersteller Artikelnummer: P9406
Alternativnummer: ABN-P9406-25
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human PDCD6IP (Q8WUM4, 1 a.a. - 392 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 10015
Puffer: In 20mM Tris-HCl pH 8.0 (1 mM DTT and 10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYK
Target-Kategorie: PDCD6IP
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.