PLAUR (Human) Recombinant Protein, Insect

Artikelnummer: ABN-P9408
Artikelname: PLAUR (Human) Recombinant Protein, Insect
Artikelnummer: ABN-P9408
Hersteller Artikelnummer: P9408
Alternativnummer: ABN-P9408-2
Hersteller: Abnova
Wirt: Insect
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human PLAUR (Q03405, 23 a.a. - 305 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag: His
UniProt: 5329
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Liquid
Sequenz: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGD
Target-Kategorie: PLAUR
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.