SFTPB (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P9409
Artikelname: SFTPB (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P9409
Hersteller Artikelnummer: P9409
Alternativnummer: ABN-P9409-2
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human SFTPB (P07988, 25 a.a. - 381 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 6439
Puffer: Lyophilized from sterile distilled Water
Formulierung: Lyophilized
Sequenz: WTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCS
Target-Kategorie: SFTPB
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.