STK11 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9410
Artikelname: STK11 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9410
Hersteller Artikelnummer: P9410
Alternativnummer: ABN-P9410-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human STK11 (Q15831, 1 a.a. - 433 a.a.) full recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 6794
Puffer: In 20mM Tris-HCl pH 8.0 (10% glycerol)
Formulierung: Liquid
Sequenz: MGSSHHHHHHSSGLVPRGSHMGSMEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTF
Target-Kategorie: STK11
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.