THPO (Human) Recombinant Protein, Mammal

Artikelnummer: ABN-P9411
Artikelname: THPO (Human) Recombinant Protein, Mammal
Artikelnummer: ABN-P9411
Hersteller Artikelnummer: P9411
Alternativnummer: ABN-P9411-2
Hersteller: Abnova
Wirt: Mammal
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Human THPO (P40225, 22 a.a. - 353 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Tag: His
UniProt: 7066
Puffer: In PBS pH 7.4 (10% glycerol)
Formulierung: Lyophilized
Sequenz: DGSHMSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLG
Target-Kategorie: THPO
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.