CXCL14 (Human) Recombinant Protein, E. coli

Artikelnummer: ABN-P9419
Artikelname: CXCL14 (Human) Recombinant Protein, E. coli
Artikelnummer: ABN-P9419
Hersteller Artikelnummer: P9419
Alternativnummer: ABN-P9419-5
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: SDS-PAGE
Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 9547
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: MKHHHHHHASSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Target-Kategorie: CXCL14
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.