CXCL14 (Human) Recombinant Protein, E. coli
Artikelnummer:
ABN-P9419
- Bilder (0)
Artikelname: | CXCL14 (Human) Recombinant Protein, E. coli |
Artikelnummer: | ABN-P9419 |
Hersteller Artikelnummer: | P9419 |
Alternativnummer: | ABN-P9419-5 |
Hersteller: | Abnova |
Wirt: | E. coli |
Kategorie: | Proteine/Peptide |
Applikation: | SDS-PAGE |
Human CXCL14 (O95715, 35 a.a. - 111 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli. |
Tag: | His |
UniProt: | 9547 |
Puffer: | Lyophilized from sterile distilled Water is > 100 ug/mL |
Formulierung: | Lyophilized |
Sequenz: | MKHHHHHHASSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Target-Kategorie: | CXCL14 |
Application Verdünnung: | Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user. |