Cxcl14 (Mouse) Recombinant Protein, E. coli

Artikelnummer: ABN-P9421
Artikelname: Cxcl14 (Mouse) Recombinant Protein, E. coli
Artikelnummer: ABN-P9421
Hersteller Artikelnummer: P9421
Alternativnummer: ABN-P9421-20
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Mouse Cxcl14 (Q9WUQ5, 23 a.a. - 99 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 57266
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Target-Kategorie: Cxcl14
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.