Ccl6 (Rat) Recombinant Protein, E. coli

Artikelnummer: ABN-P9424
Artikelname: Ccl6 (Rat) Recombinant Protein, E. coli
Artikelnummer: ABN-P9424
Hersteller Artikelnummer: P9424
Alternativnummer: ABN-P9424-2
Hersteller: Abnova
Wirt: E. coli
Kategorie: Proteine/Peptide
Applikation: FA, SDS-PAGE
Rat Ccl6 (Q68FP3, 22 a.a. - 115 a.a.) partial recombinant protein expressed in Escherichia coli.
UniProt: 287910
Puffer: Lyophilized from sterile distilled Water is > 100 ug/mL
Formulierung: Lyophilized
Sequenz: GLIQDTVKEDRPFNPTIIHQGFQDSSDCCFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTCISTLKLGPRSGNSAIA
Target-Kategorie: Ccl6
Application Verdünnung: Biological ActivitySDS-PAGEThe optimal working dilution should be determined by the end user.